LL-37 (scrambled) trifluoroacetate salt,CAS: 1354065-56-7

LL-37 (scrambled) trifluoroacetate salt

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-905	0.5mg	190.00	- +	+ Add to cart
R-M-905	1mg	310.00	- +	+ Add to cart

Product description

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	1354065-56-7
Sequence	GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Synonyms	Cationic Antimicrobial Protein 18 (134-170) (Scrambled) (human), hCAP-18 (134-170)
Molecular Formula	C₂₀₅H₃₄₀N₆₀O₅₃
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document